PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G066600.1.p
Common NameGLYMA_13G066600, LOC100815077
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 376aa    MW: 41134.2 Da    PI: 6.6931
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G066600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-184491148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         rg WT+eEd +++ +v+ +G+g+W++++++ g++R++k+c++rw +yl
  Glyma.13G066600.1.p 44 RGLWTPEEDAKILAYVANHGTGNWTLVPKKAGLNRCGKSCRLRWTNYL 91
                         788*******************************************97 PP

2Myb_DNA-binding44.63.4e-14100140446
                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +T++E++l+++++   G++ W++Ia++++ gRt++++k++w++
  Glyma.13G066600.1.p 100 FTPQEEDLIINLHGAIGSR-WSLIAKRLP-GRTDNDVKNYWNT 140
                          9******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-253594IPR009057Homeodomain-like
PROSITE profilePS5129427.3713995IPR017930Myb domain
SuperFamilySSF466891.88E-3041138IPR009057Homeodomain-like
SMARTSM007175.5E-154393IPR001005SANT/Myb domain
PfamPF002493.0E-174491IPR001005SANT/Myb domain
CDDcd001675.56E-124791No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2395146IPR009057Homeodomain-like
PROSITE profilePS5129416.95396146IPR017930Myb domain
SMARTSM007174.3E-1396144IPR001005SANT/Myb domain
CDDcd001671.24E-10100142No hitNo description
PfamPF002494.7E-13100140IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MHIASPLHNS LSPSLAFLLL LCLISSLISK MGRPPCCDKS NVKRGLWTPE EDAKILAYVA  60
NHGTGNWTLV PKKAGLNRCG KSCRLRWTNY LRPDLKHDGF TPQEEDLIIN LHGAIGSRWS  120
LIAKRLPGRT DNDVKNYWNT KLRKKLMKMG IDPVTHKPVS QVLSDLGSIS GLPNTTNQMA  180
FINKDLMMSN MPPTKTEPSD SNKSMVEHTQ EGQVHSWEHH IPYQVIINSE NVQPQVLSEA  240
ASSTSSSSSS NLTQLGSPQS YSCQTPQAQI SPPCSSFDWS EFLHSDSFNW SLNPPSGLMQ  300
SEAELSDNTK SNGHDMQGAA SEGSGSGSGA VACGASMEYQ INKQCEAHSF VDGILDRDSE  360
IRAAFPQLLD ASFDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28441467108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-172AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543842.20.0PREDICTED: transcription factor MYB35-like
TrEMBLA0A0R0GT360.0A0A0R0GT36_SOYBN; Uncharacterized protein
STRINGGLYMA13G04920.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.14e-85MYB family protein